PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00264g04030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 239aa    MW: 27476.3 Da    PI: 9.337
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00264g04030.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF75.15.5e-244191151
                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                              k+ien++ rq t+skR+ gi KKA+EL vLCd++va+++fs+tg+l  yss
  Peinf101Scf00264g04030.1 41 KKIENSTSRQQTYSKRKDGIVKKANELAVLCDTDVALLMFSPTGQLTSYSS 91
                              68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-313392IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.243393IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-2634107IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-213555IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003589IPR002100Transcription factor, MADS-box
PfamPF003191.7E-224289IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-215570IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-217091IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MTNSASFIRL SCSFLIFPFL TFIHSSSSLH PFMGRNKLVM KKIENSTSRQ QTYSKRKDGI  60
VKKANELAVL CDTDVALLMF SPTGQLTSYS SRGSVEDIML RVVNQPGELN RRFIPDEQHM  120
SQRLTQLKYE GEMAHEEKLN KLARRLREAR EKLRYYEPRM KEINSVQEAV ACQQFLMSAL  180
ERIQQSKAKL LGSEEFIQRN ENVEVASVNA EDSADASNRV AYSNLRDESY EKQTGPRLH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016439162.11e-107PREDICTED: agamous-like MADS-box protein AGL66 isoform X1
TrEMBLA0A0V0HT183e-74A0A0V0HT18_SOLCH; Putative MADS-box protein defh21-like
STRINGSolyc07g052700.2.11e-59(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52921836
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.26e-25AGAMOUS-like 67